General Information

  • ID:  hor000003
  • Uniprot ID:  Q7TNK8
  • Protein name:  Adrenomedullin-2
  • Gene name:  Adm2
  • Organism:  Mus musculus (Mouse)
  • Family:  Adrenomedullin family
  • Source:  Animal
  • Expression:  High expression detected in the submaxillary gland, kidney, stomach, and mesentery, followed by the pituitary, lung, pancreas, intestines, spleen, thymus and ovary. Expressed mainly in the intermediate lobe of the pituitary, with sporadic in the anterior
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0044877 protein-containing complex binding
  • GO BP:  GO:0001525 angiogenesis; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0010460 positive regulation of heart rate; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0045776 negative regulation of blood pressure
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY
  • Length:  47(103-149)
  • Propeptide:  MAQLLMVTVTLGCISLLYLLPGTLSGSLGKGLRHSRPREPPAKIPSSNLQPGHPSLQPVVWKSRRHAPQPQGRGNRALAMVHLPQGGGSRHPGPQRPTGSRRPHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSYG
  • Signal peptide:  MAQLLMVTVTLGCISLLYLLPGTLS
  • Modification:  T47 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  IMD acutely augments cardiomyocyte contractile function ;enhances angiogenesis; IMD is a novel hypoxia-induced gene and a potential interventional agent for the improvement of endothelial barrier function in systemic inflammatory responses and hypoxia-ind
  • Mechanism:  IMD acutely augments cardiomyocyte contractile function through at least in part a protein kinase C- and protein kinase A-dependent mechanism;IMD enhances angiogenesis through ERK, Akt/NOS/NO, and VEGF/VEGFR-2 signaling pathways; IMD decreased basal and thrombin-induced hyperpermeability of an endothelial cell monolayer in a receptor-dependent manner and activated PKA in these cells;Intermedin attenuates macrophage foam-cell formation via tristetraprolin-mediated degradation of CD36 mRNA;IMD reduces bone resorption by inhibiting osteoblast apoptosis decreasing the RANKL/OPG ratio and the expression of M-CSF and inhibiting osteoclast maturation and differentiation.;enhances subcutaneous White Adipose Tissue beiging via a direct effect by activating the CRLR.RAMP1-cAMP/PKA and p38 MAPK pathways in white adipocytes and via an indirect effect by stimulating alternative M2 polarization in macrophages.
  • Cross BBB:  NA
  • Target:  Calcrl, Ramp3
  • Target Unid:  Q9R1W5, Q9WUP1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q7TNK8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q7TNK8-F1.pdbhor000003_AF2.pdbhor000003_ESM.pdb

Physical Information

Mass: 602462 Formula: C226H362N74O64S2
Absent amino acids: EFIKM Common amino acids: L
pI: 9.59 Basic residues: 8
Polar residues: 13 Hydrophobic residues: 15
Hydrophobicity: -39.36 Boman Index: -9167
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 87.02
Instability Index: 5752.13 Extinction Coefficient cystines: 7115
Absorbance 280nm: 154.67

Literature

  • PubMed ID:  14706825
  • Title:  Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator.